PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG042188t1
Common NameTCM_042188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 487aa    MW: 53334 Da    PI: 10.3117
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG042188t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.51.2e-12188245562
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       k+ rr ++NR++A++sR +K++++ e e+kv++Lea+   L+ ++  ++++  +l++e
  Thecc1EG042188t1 188 KKLRRVISNRISAQKSRMKKLQYVSEMEKKVEVLEAQIAVLAPQVALYRNQKHYLQME 245
                       899**********************************999999999998888877766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-14184248IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.749186249IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.4E-15188243No hitNo description
PfamPF001703.5E-10188245IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.42E-12188243No hitNo description
CDDcd147032.81E-18189239No hitNo description
PROSITE patternPS000360191206IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MEGKNKKIAQ ETPAAASTRR KSATNARSIA SMSPSNLPKA PTSFQGWKKP SFMHHAGAAG  60
ASGSGTNTSS FQAPDPFSMK GEKNKTISLQ EPNPLSMKGE KNKTSFFQAP DPLSMKLVEK  120
NKTSFFRTPD PLSMKGEKNK RIDQNPSPTS NQNLTLKISD GVNSDKTEVG NGAAVRWGRK  180
LDLDMDPKKL RRVISNRISA QKSRMKKLQY VSEMEKKVEV LEAQIAVLAP QVALYRNQKH  240
YLQMEQKGLK QRIAACAARK SLVDAEVEMN KAELNRLRQL QMAQQQQKLQ AQASMGGWEH  300
GFTLQMVNPG LSQSGTGHTM YVHPNQGTTW TDSTAWLGTR ARTAAKYGLQ PTWTGAVAEP  360
KLESINTAAE WGSEPNPGRA VAESKLESIN ADFKLESINT AAEWESQRPN PGRAVAESKL  420
ESINAESKLE SINTTAEWES QPNPGRAVSE SKLESINTAA EWESQPKPGR AGAAPEHEPW  480
ESKPSQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016941.10.0Uncharacterized protein TCM_042188
TrEMBLA0A061GXH30.0A0A061GXH3_THECC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2231545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.25e-22bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]